PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.07G005800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 358aa    MW: 40301.8 Da    PI: 6.271
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.07G005800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-162168148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g W++eEde+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
  Manes.07G005800.1.p 21 KGLWSPEEDEKLIKYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 68
                         678*******************************************97 PP

2Myb_DNA-binding51.72.1e-1674117146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rg+++++E+el+++++  lG++ W+ Ia++++ gRt++++k++w++
  Manes.07G005800.1.p  74 RGAFSPQEEELIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 117
                          89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.5871668IPR017930Myb domain
SuperFamilySSF466899.77E-2919115IPR009057Homeodomain-like
SMARTSM007171.2E-122070IPR001005SANT/Myb domain
PfamPF002491.6E-142168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-242275IPR009057Homeodomain-like
CDDcd001674.47E-102468No hitNo description
PROSITE profilePS5129425.85969123IPR017930Myb domain
SMARTSM007176.6E-1673121IPR001005SANT/Myb domain
PfamPF002493.4E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2676123IPR009057Homeodomain-like
CDDcd001671.08E-1076116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MRKPDLMGKE RVNNNKAKLR KGLWSPEEDE KLIKYMLTNG QGCWSDIARN AGLQRCGKSC  60
RLRWINYLRP DLKRGAFSPQ EEELIIHLHS ILGNRWSQIA ARLPGRTDNE IKNFWNSALK  120
KRLKIIGNNN NNNPSTTSPN ESDSSEPRDH VVGNGMSMHH DHDLMTMCID SSSSSSASIQ  180
AMVAGNANGN QFDPFSILNN NRFEGTAAAG LFDMPTCLTQ VGMGGDGFYG DYGILESHHN  240
KVGLERDLCL PPLESSRSLE EENNNNNNTN TNNVVTNHSI ISMKSNINHN NNINNHLINN  300
NSCFNNTDHH QLQSLKVEDM FGFENHWQGE NLRMGEWDLE GLMENISSFP FLDFQVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261912325128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1486761e-105KF148676.1 Populus trichocarpa MYB transcription factor (MYB20) mRNA, complete cds.
GenBankKT2613411e-105KT261341.1 Fraxinus mandshurica transcription factor MYB2 (MYB2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015582546.10.0PREDICTED: transcription factor MYB46
TrEMBLA0A067LFZ91e-169A0A067LFZ9_JATCU; MYB family protein
STRINGPOPTR_0009s06630.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.14e-73myb domain protein 83